SCOP 1.75: Domain d2fklb1: 2fkl B:126-189

Lineage for d2fklb1 (2fkl B:126-189)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (1 family)

5. Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (1 protein)

6. Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89814] (2 PDB entries)

8. Domain d2fklb1: 2fkl B:126-189 [133659]
   automatically matched to d1owta_

Details for d2fklb1

PDB Entry: 2fkl, 2.5 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain (Residues 126- 189 of APP)

PDB Compounds: (B:) Amyloid beta A4 protein precursor

SCOP Domain Sequences for d2fklb1:

Sequence; same for both SEQRES and ATOM records:

>d2fklb1 d.230.3.1 (B:126-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv
ccpl

Timeline for d2fklb1:

• d2fklb1 first appeared in SCOP 1.73
  
• d2fklb1 is called d2fklb_ in SCOPe 2.01
  
• d2fklb1 appears in the current release, SCOPe 2.08, called d2fklb_