Lineage for d2fklb1 (2fkl B:126-189)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740555Fold d.230: Dodecin subunit-like [88797] (5 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 740590Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (1 family) (S)
  5. 740591Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (1 protein)
  6. 740592Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 740593Species Human (Homo sapiens) [TaxId:9606] [89814] (2 PDB entries)
  8. 740595Domain d2fklb1: 2fkl B:126-189 [133659]
    automatically matched to d1owta_

Details for d2fklb1

PDB Entry: 2fkl (more details), 2.5 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain (Residues 126- 189 of APP)
PDB Compounds: (B:) Amyloid beta A4 protein precursor

SCOP Domain Sequences for d2fklb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fklb1 d.230.3.1 (B:126-189) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv
ccpl

SCOP Domain Coordinates for d2fklb1:

Click to download the PDB-style file with coordinates for d2fklb1.
(The format of our PDB-style files is described here.)

Timeline for d2fklb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fkla1