SCOPe 2.08: Domain d2fklb_: 2fkl B:

Lineage for d2fklb_ (2fkl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families)
   automatically mapped to Pfam PF12924

5. Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)

6. Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)

8. Domain d2fklb_: 2fkl B: [133659]
   automated match to d1owta_

Details for d2fklb_

PDB Entry: 2fkl, 2.5 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain (Residues 126- 189 of APP)

PDB Compounds: (B:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fklb_:

Sequence; same for both SEQRES and ATOM records:

>d2fklb_ d.230.3.1 (B:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv
ccpl

Timeline for d2fklb_:

• d2fklb_ first appeared in SCOP 1.73, called d2fklb1
  
• d2fklb_ appears in SCOPe 2.07