Lineage for d2fklb_ (2fkl B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564565Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2564744Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) (S)
    automatically mapped to Pfam PF12924
  5. 2564745Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 2564746Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 2564747Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 2564760Domain d2fklb_: 2fkl B: [133659]
    automated match to d1owta_

Details for d2fklb_

PDB Entry: 2fkl (more details), 2.5 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain (Residues 126- 189 of APP)
PDB Compounds: (B:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fklb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fklb_ d.230.3.1 (B:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv
ccpl

SCOPe Domain Coordinates for d2fklb_:

Click to download the PDB-style file with coordinates for d2fklb_.
(The format of our PDB-style files is described here.)

Timeline for d2fklb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fkla_