Lineage for d2fkla_ (2fkl A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240281Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2240447Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) (S)
    automatically mapped to Pfam PF12924
  5. 2240448Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins)
  6. 2240449Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species)
  7. 2240450Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries)
  8. 2240462Domain d2fkla_: 2fkl A: [133658]
    automated match to d1owta_

Details for d2fkla_

PDB Entry: 2fkl (more details), 2.5 Å

PDB Description: Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain (Residues 126- 189 of APP)
PDB Compounds: (A:) Amyloid beta A4 protein precursor

SCOPe Domain Sequences for d2fkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkla_ d.230.3.1 (A:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]}
allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv
ccpl

SCOPe Domain Coordinates for d2fkla_:

Click to download the PDB-style file with coordinates for d2fkla_.
(The format of our PDB-style files is described here.)

Timeline for d2fkla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fklb_