Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.3: Amyloid beta a4 protein copper binding domain (domain 2) [89811] (2 families) automatically mapped to Pfam PF12924 |
Family d.230.3.1: Amyloid beta a4 protein copper binding domain (domain 2) [89812] (2 proteins) |
Protein Amyloid beta a4 protein copper binding domain (domain 2) [89813] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89814] (6 PDB entries) |
Domain d2fkla_: 2fkl A: [133658] automated match to d1owta_ |
PDB Entry: 2fkl (more details), 2.5 Å
SCOPe Domain Sequences for d2fkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkla_ d.230.3.1 (A:) Amyloid beta a4 protein copper binding domain (domain 2) {Human (Homo sapiens) [TaxId: 9606]} allvpdkckflhqermdvcethlhwhtvaketcsekstnlhdygmllpcgidkfrgvefv ccpl
Timeline for d2fkla_: