![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.3: YjbR-like [142906] (1 family) ![]() overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet automatically mapped to Pfam PF04237 |
![]() | Family d.198.3.1: YjbR-like [142907] (2 proteins) Pfam PF04237; DUF419 |
![]() | Protein Hypothetical protein YjbR [142910] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [142911] (1 PDB entry) Uniprot P0AF50 1-118 |
![]() | Domain d2fkia1: 2fki A:1-118 [133657] |
PDB Entry: 2fki (more details)
SCOPe Domain Sequences for d2fkia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkia1 d.198.3.1 (A:1-118) Hypothetical protein YjbR {Escherichia coli [TaxId: 562]} mtisellqycmakpgaeqsvhndwkatqikvedvlfamvkevenrpavslktspelaell rqqhsdvrpsrhlnkahwstvyldgslpdsqiyylvdasyqqavnllpeekrkllvql
Timeline for d2fkia1: