Lineage for d2fkia1 (2fki A:1-118)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3006065Superfamily d.198.3: YjbR-like [142906] (1 family) (S)
    overall similar to the Type III secretory system chaperone subunits; different shape of the beta-sheet
    automatically mapped to Pfam PF04237
  5. 3006066Family d.198.3.1: YjbR-like [142907] (2 proteins)
    Pfam PF04237; DUF419
  6. 3006070Protein Hypothetical protein YjbR [142910] (1 species)
  7. 3006071Species Escherichia coli [TaxId:562] [142911] (1 PDB entry)
    Uniprot P0AF50 1-118
  8. 3006072Domain d2fkia1: 2fki A:1-118 [133657]

Details for d2fkia1

PDB Entry: 2fki (more details)

PDB Description: nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226
PDB Compounds: (A:) Protein yjbR

SCOPe Domain Sequences for d2fkia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkia1 d.198.3.1 (A:1-118) Hypothetical protein YjbR {Escherichia coli [TaxId: 562]}
mtisellqycmakpgaeqsvhndwkatqikvedvlfamvkevenrpavslktspelaell
rqqhsdvrpsrhlnkahwstvyldgslpdsqiyylvdasyqqavnllpeekrkllvql

SCOPe Domain Coordinates for d2fkia1:

Click to download the PDB-style file with coordinates for d2fkia1.
(The format of our PDB-style files is described here.)

Timeline for d2fkia1: