![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) ![]() contains a single copy of this fold and an extra beta-strand at the C-terminus |
![]() | Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
![]() | Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries) |
![]() | Domain d2fkfa4: 2fkf A:368-463 [133656] Other proteins in same PDB: d2fkfa1, d2fkfa2, d2fkfa3 automated match to d1p5dx4 complexed with g16, zn |
PDB Entry: 2fkf (more details), 2 Å
SCOPe Domain Sequences for d2fkfa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkfa4 d.129.2.1 (A:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp vlvlrfeadteeeleriktvfrnqlkavdsslpvpf
Timeline for d2fkfa4: