Lineage for d2fkfa4 (2fkf A:368-463)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538746Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2538955Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2538956Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2538980Protein Phosphomannomutase/phosphoglucomutase [81375] (1 species)
  7. 2538981Species Pseudomonas aeruginosa [TaxId:287] [81374] (12 PDB entries)
  8. 2538993Domain d2fkfa4: 2fkf A:368-463 [133656]
    Other proteins in same PDB: d2fkfa1, d2fkfa2, d2fkfa3
    automated match to d1p5dx4
    complexed with g16, zn

Details for d2fkfa4

PDB Entry: 2fkf (more details), 2 Å

PDB Description: phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2fkfa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkfa4 d.129.2.1 (A:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
psdistpeinitvtedskfaiiealqrdaqwgegnittldgvrvdypkgwglvrasnttp
vlvlrfeadteeeleriktvfrnqlkavdsslpvpf

SCOPe Domain Coordinates for d2fkfa4:

Click to download the PDB-style file with coordinates for d2fkfa4.
(The format of our PDB-style files is described here.)

Timeline for d2fkfa4: