SCOPe 2.06: Domain d2fkfa3: 2fkf A:259-367

Lineage for d2fkfa3 (2fkf A:259-367)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
   consists of three similar domains with 3 layers (a/b/a) each; duplication
   core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest

4. Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families)

5. Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)

6. Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)

8. Domain d2fkfa3: 2fkf A:259-367 [133655]
   Other proteins in same PDB: d2fkfa4
   automated match to d1p5dx3
   complexed with g16, zn

Details for d2fkfa3

PDB Entry: 2fkf, 2 Å

PDB Description: phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound

PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2fkfa3:

Sequence; same for both SEQRES and ATOM records:

>d2fkfa3 c.84.1.1 (A:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

Timeline for d2fkfa3:

• d2fkfa3 first appeared in SCOP 1.73
  
• d2fkfa3 appears in SCOPe 2.05
  
• d2fkfa3 appears in SCOPe 2.07
  
• d2fkfa3 appears in the current release, SCOPe 2.08