Lineage for d2fkfa2 (2fkf A:155-258)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 709628Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 709629Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 709630Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 709683Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 709684Species Pseudomonas aeruginosa [TaxId:287] [69608] (10 PDB entries)
  8. 709707Domain d2fkfa2: 2fkf A:155-258 [133654]
    Other proteins in same PDB: d2fkfa4
    automatically matched to d1k2yx2
    complexed with g16, zn

Details for d2fkfa2

PDB Entry: 2fkf (more details), 2 Å

PDB Description: phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOP Domain Sequences for d2fkfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkfa2 c.84.1.1 (A:155-258) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh
pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii

SCOP Domain Coordinates for d2fkfa2:

Click to download the PDB-style file with coordinates for d2fkfa2.
(The format of our PDB-style files is described here.)

Timeline for d2fkfa2: