Lineage for d2fkfa1 (2fkf A:9-154)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1876643Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 1876644Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 1876645Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 1876698Protein Phosphomannomutase/phosphoglucomutase [69607] (1 species)
  7. 1876699Species Pseudomonas aeruginosa [TaxId:287] [69608] (12 PDB entries)
  8. 1876727Domain d2fkfa1: 2fkf A:9-154 [133653]
    Other proteins in same PDB: d2fkfa4
    automated match to d1k2yx1
    complexed with g16, zn

Details for d2fkfa1

PDB Entry: 2fkf (more details), 2 Å

PDB Description: phosphomannomutase/phosphoglucomutase from pseudomonas aeruginosa with alpha-d-glucose 1,6-bisphosphate bound
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2fkfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkfa1 c.84.1.1 (A:9-154) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d2fkfa1:

Click to download the PDB-style file with coordinates for d2fkfa1.
(The format of our PDB-style files is described here.)

Timeline for d2fkfa1: