SCOPe 2.07: Domain d2fkbc_: 2fkb C:

Lineage for d2fkbc_ (2fkb C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein automated matches [190207] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187715] (1 PDB entry)

8. Domain d2fkbc_: 2fkb C: [133652]
   Other proteins in same PDB: d2fkba1
   automated match to d2fkba1
   complexed with act, gol, mg, so4

Details for d2fkbc_

PDB Entry: 2fkb, 2 Å

PDB Description: crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12

PDB Compounds: (C:) Putative Nudix hydrolase yfcD

SCOPe Domain Sequences for d2fkbc_:

Sequence; same for both SEQRES and ATOM records:

>d2fkbc_ d.113.1.2 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
eqrrlastewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkd
flpgmldataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfs
cvshgpfalqedevsevcwltpeeitarcdeftpdslkalalwmkrn

Timeline for d2fkbc_:

• d2fkbc_ first appeared in SCOP 1.73, called d2fkbc1
  
• d2fkbc_ appears in SCOPe 2.06
  
• d2fkbc_ appears in the current release, SCOPe 2.08