SCOP 1.73: Domain d2fkbb1: 2fkb B:8-168

Lineage for d2fkbb1 (2fkb B:8-168)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (3 proteins)

6. Protein Hypothetical protein YfcD [143770] (1 species)

7. Species Escherichia coli [TaxId:562] [143771] (1 PDB entry)

8. Domain d2fkbb1: 2fkb B:8-168 [133651]
   automatically matched to 2FKB A:8-168
   complexed with act, gol, mg, so4

Details for d2fkbb1

PDB Entry: 2fkb, 2 Å

PDB Description: crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12

PDB Compounds: (B:) Putative Nudix hydrolase yfcD

SCOP Domain Sequences for d2fkbb1:

Sequence; same for both SEQRES and ATOM records:

>d2fkbb1 d.113.1.2 (B:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]}
stewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgml
dataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgp
falqedevsevcwltpeeitarcdeftpdslkalalwmkrn

Timeline for d2fkbb1:

• d2fkbb1 is new in SCOP 1.73
  
• d2fkbb1 appears in SCOP 1.75
  
• d2fkbb1 appears in the current release, SCOPe 2.08, called d2fkbb_