Lineage for d2fkbb_ (2fkb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971711Protein automated matches [190207] (2 species)
    not a true protein
  7. 2971712Species Escherichia coli K-12 [TaxId:83333] [187715] (1 PDB entry)
  8. 2971713Domain d2fkbb_: 2fkb B: [133651]
    Other proteins in same PDB: d2fkba1
    automated match to d2fkba1
    complexed with act, gol, mg, so4

Details for d2fkbb_

PDB Entry: 2fkb (more details), 2 Å

PDB Description: crystal structure of a putative enzyme (possible nudix hydrolase) from escherichia coli k12
PDB Compounds: (B:) Putative Nudix hydrolase yfcD

SCOPe Domain Sequences for d2fkbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkbb_ d.113.1.2 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
stewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgml
dataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgp
falqedevsevcwltpeeitarcdeftpdslkalalwmkrn

SCOPe Domain Coordinates for d2fkbb_:

Click to download the PDB-style file with coordinates for d2fkbb_.
(The format of our PDB-style files is described here.)

Timeline for d2fkbb_: