Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
Protein automated matches [190207] (2 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [187715] (1 PDB entry) |
Domain d2fkbb_: 2fkb B: [133651] Other proteins in same PDB: d2fkba1 automated match to d2fkba1 complexed with act, gol, mg, so4 |
PDB Entry: 2fkb (more details), 2 Å
SCOPe Domain Sequences for d2fkbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkbb_ d.113.1.2 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} stewvdivneeneviaqasreqmraqclrhratyivvhdgmgkilvqrrtetkdflpgml dataggvvqadeqllesarreaeeelgiagvpfaehgqfyfedkncrvwgalfscvshgp falqedevsevcwltpeeitarcdeftpdslkalalwmkrn
Timeline for d2fkbb_: