Lineage for d2fkaa1 (2fka A:2-129)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 825506Superfamily c.23.1: CheY-like [52172] (7 families) (S)
  5. 825507Family c.23.1.1: CheY-related [52173] (25 proteins)
  6. 825521Protein CheY protein [52174] (4 species)
  7. 825580Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)
  8. 825581Domain d2fkaa1: 2fka A:2-129 [133649]
    automatically matched to d2che__
    complexed with bef, cxs, mg, so4

Details for d2fkaa1

PDB Entry: 2fka (more details), 2 Å

PDB Description: Crystal structure of Mg(2+) and BeF(3)(-)-bound CheY in complex with CheZ(200-214) solved from a F432 crystal grown in CAPS (pH 10.5)
PDB Compounds: (A:) Chemotaxis protein cheY

SCOP Domain Sequences for d2fkaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkaa1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOP Domain Coordinates for d2fkaa1:

Click to download the PDB-style file with coordinates for d2fkaa1.
(The format of our PDB-style files is described here.)

Timeline for d2fkaa1: