![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.7: RNase Z-like [143916] (1 protein) part of Pfam PF00753; tRNA 3'-endonuclease; elaborated with additional structures and insert alpha(2)-beta(2) subdomain |
![]() | Protein Ribonuclease Z (RNase Z) [143917] (3 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [143918] (2 PDB entries) Uniprot P54548 1-307 |
![]() | Domain d2fk6a1: 2fk6 A:1-307 [133646] protein/RNA complex; complexed with gol, mes, zn |
PDB Entry: 2fk6 (more details), 2.9 Å
SCOPe Domain Sequences for d2fk6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fk6a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif ithmagdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl evnvprg
Timeline for d2fk6a1: