Lineage for d2fk6a1 (2fk6 A:1-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2997156Family d.157.1.7: RNase Z-like [143916] (1 protein)
    part of Pfam PF00753; tRNA 3'-endonuclease; elaborated with additional structures and insert alpha(2)-beta(2) subdomain
  6. 2997157Protein Ribonuclease Z (RNase Z) [143917] (3 species)
  7. 2997158Species Bacillus subtilis [TaxId:1423] [143918] (2 PDB entries)
    Uniprot P54548 1-307
  8. 2997161Domain d2fk6a1: 2fk6 A:1-307 [133646]
    protein/RNA complex; complexed with gol, mes, zn

Details for d2fk6a1

PDB Entry: 2fk6 (more details), 2.9 Å

PDB Description: crystal structure of rnase z/trna(thr) complex
PDB Compounds: (A:) ribonuclease z

SCOPe Domain Sequences for d2fk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk6a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]}
mellflgtgagipakarnvtsvalklleerrsvwlfdcgeatqhqmlhttikprkiekif
ithmagdhvyglpgllgsrsfqggedeltvygpkgikafietslavtkthltyplaiqei
eegivfeddqfivtavsvihgveafgyrvqekdvpgslkadvlkemnippgpvyqkikkg
etvtledgriingndfleppkkgrsvvfsgdtrvsdklkelardcdvmvheatfakedrk
laydyyhstteqaavtakearakqlilthisaryqgdaslelqkeavdvfpnsvaaydfl
evnvprg

SCOPe Domain Coordinates for d2fk6a1:

Click to download the PDB-style file with coordinates for d2fk6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk6a1: