Lineage for d2fk0m_ (2fk0 M:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778497Protein automated matches [190291] (24 species)
    not a true protein
  7. 1778560Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 1778566Domain d2fk0m_: 2fk0 M: [133640]
    Other proteins in same PDB: d2fk0a1, d2fk0b1, d2fk0d_, d2fk0f_, d2fk0h_, d2fk0j_, d2fk0l_, d2fk0n_, d2fk0p_, d2fk0r_
    automated match to d1jsma_

Details for d2fk0m_

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: Crystal Structure of a H5N1 influenza virus hemagglutinin.
PDB Compounds: (M:) Hemagglutinin

SCOPe Domain Sequences for d2fk0m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0m_ b.19.1.2 (M:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0m_:

Click to download the PDB-style file with coordinates for d2fk0m_.
(The format of our PDB-style files is described here.)

Timeline for d2fk0m_: