Lineage for d2fk0k_ (2fk0 K:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942760Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 942761Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 942806Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 942967Protein automated matches [190291] (4 species)
    not a true protein
  7. 942968Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 942973Domain d2fk0k_: 2fk0 K: [133638]
    Other proteins in same PDB: d2fk0a1, d2fk0b1, d2fk0d1, d2fk0f1, d2fk0h1, d2fk0j1, d2fk0l1, d2fk0n1, d2fk0p1, d2fk0r1
    automated match to d1jsma_

Details for d2fk0k_

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d2fk0k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0k_ b.19.1.2 (K:) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
gdqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvag
wllgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipk
sswssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgih
hpndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndai
nfesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihplti
gecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0k_:

Click to download the PDB-style file with coordinates for d2fk0k_.
(The format of our PDB-style files is described here.)

Timeline for d2fk0k_: