Lineage for d2fk0a1 (2fk0 A:11-324)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1305775Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)
  8. 1306035Domain d2fk0a1: 2fk0 A:11-324 [133628]
    Other proteins in same PDB: d2fk0b1, d2fk0c_, d2fk0d_, d2fk0e_, d2fk0f_, d2fk0g_, d2fk0h_, d2fk0i_, d2fk0j_, d2fk0k_, d2fk0l_, d2fk0m_, d2fk0n_, d2fk0o_, d2fk0p_, d2fk0q_, d2fk0r_

Details for d2fk0a1

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: Crystal Structure of a H5N1 influenza virus hemagglutinin.
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2fk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0a1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0a1:

Click to download the PDB-style file with coordinates for d2fk0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk0a1: