SCOP 1.73: Domain d2fjyb1: 2fjy B:7-142

Lineage for d2fjyb1 (2fjy B:7-142)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)

6. Protein Moth pheromone-binding protein, PBP [47569] (2 species)

7. Species Silk moth (Bombyx mori) [TaxId:7091] [47570] (6 PDB entries)

8. Domain d2fjyb1: 2fjy B:7-142 [133627]
   automatically matched to d1gm0a_

Details for d2fjyb1

PDB Entry: 2fjy, 2.3 Å

PDB Description: crystal structure of b-form bombyx mori pheromone binding protein

PDB Compounds: (B:) pheromone-binding protein

SCOP Domain Sequences for d2fjyb1:

Sequence; same for both SEQRES and ATOM records:

>d2fjyb1 a.39.2.1 (B:7-142) Moth pheromone-binding protein, PBP {Silk moth (Bombyx mori) [TaxId: 7091]}
nlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstklnmldpeg
nlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfkaeihkln
wapsmdvavgeilaev

Timeline for d2fjyb1:

• d2fjyb1 is new in SCOP 1.73
  
• d2fjyb1 appears in SCOP 1.75
  
• d2fjyb1 appears in the current release, SCOPe 2.08, called d2fjyb_