Lineage for d2fjyb_ (2fjy B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711839Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 2711844Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries)
  8. 2711848Domain d2fjyb_: 2fjy B: [133627]
    automated match to d1gm0a_

Details for d2fjyb_

PDB Entry: 2fjy (more details), 2.3 Å

PDB Description: crystal structure of b-form bombyx mori pheromone binding protein
PDB Compounds: (B:) pheromone-binding protein

SCOPe Domain Sequences for d2fjyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjyb_ a.39.2.1 (B:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]}
sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
eihklnwapsmdvavgeilaev

SCOPe Domain Coordinates for d2fjyb_:

Click to download the PDB-style file with coordinates for d2fjyb_.
(The format of our PDB-style files is described here.)

Timeline for d2fjyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fjya_