Lineage for d2fjya1 (2fjy A:7-142)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 769304Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (1 family) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 769305Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (5 proteins)
  6. 769306Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 769311Species Silk moth (Bombyx mori) [TaxId:7091] [47570] (6 PDB entries)
  8. 769316Domain d2fjya1: 2fjy A:7-142 [133626]
    automatically matched to d1gm0a_

Details for d2fjya1

PDB Entry: 2fjy (more details), 2.3 Å

PDB Description: crystal structure of b-form bombyx mori pheromone binding protein
PDB Compounds: (A:) pheromone-binding protein

SCOP Domain Sequences for d2fjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjya1 a.39.2.1 (A:7-142) Moth pheromone-binding protein, PBP {Silk moth (Bombyx mori) [TaxId: 7091]}
nlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstklnmldpeg
nlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfkaeihkln
wapsmdvavgeilaev

SCOP Domain Coordinates for d2fjya1:

Click to download the PDB-style file with coordinates for d2fjya1.
(The format of our PDB-style files is described here.)

Timeline for d2fjya1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fjyb1