![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins) automatically mapped to Pfam PF01395 |
![]() | Protein Moth pheromone-binding protein, PBP [47569] (2 species) |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [47570] (4 PDB entries) |
![]() | Domain d2fjya_: 2fjy A: [133626] automated match to d1gm0a_ |
PDB Entry: 2fjy (more details), 2.3 Å
SCOPe Domain Sequences for d2fjya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjya_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Silkworm (Bombyx mori) [TaxId: 7091]} nlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstklnmldpeg nlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfkaeihkln wapsmdvavgeilaev
Timeline for d2fjya_: