SCOPe 2.01: Domain d2fjsa2: 2fjs A:167-337

Lineage for d2fjsa2 (2fjs A:167-337)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Nitrite reductase, NIR [49551] (5 species)
   consists of two domains of this fold

7. Species Alcaligenes xylosoxidans [TaxId:85698] [49554] (31 PDB entries)
   Uniprot O68601 25-360 ! Uniprot O68601 26-359 ! Uniprot O68601

8. Domain d2fjsa2: 2fjs A:167-337 [133617]
   automatically matched to d1ndra2
   complexed with act, cu, cu1, trs

Details for d2fjsa2

PDB Entry: 2fjs, 1.85 Å

PDB Description: crystal structure of anaerobically reduced wild type nitrite reductase from a. faecalis

PDB Compounds: (A:) Copper-containing nitrite reductase

SCOPe Domain Sequences for d2fjsa2:

Sequence; same for both SEQRES and ATOM records:

>d2fjsa2 b.6.1.3 (A:167-337) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]}
gkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavga
ltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipgg
aagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlap

Timeline for d2fjsa2:

• d2fjsa2 first appeared in SCOP 1.73
  
• d2fjsa2 appears in SCOP 1.75
  
• d2fjsa2 appears in SCOPe 2.02
  
• d2fjsa2 appears in the current release, SCOPe 2.08