Class g: Small proteins [56992] (85 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins) |
Protein Vascular endothelial growth factor, VEGF [57505] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries) |
Domain d2fjhw1: 2fjh W:14-108 [133610] automatically matched to d1katv_ |
PDB Entry: 2fjh (more details), 3.1 Å
SCOP Domain Sequences for d2fjhw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjhw1 g.17.1.1 (W:14-108) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpkk
Timeline for d2fjhw1: