SCOP 1.73: Domain d2fjhw1: 2fjh W:14-108

Lineage for d2fjhw1 (2fjh W:14-108)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries)

8. Domain d2fjhw1: 2fjh W:14-108 [133610]
   automatically matched to d1katv_

Details for d2fjhw1

PDB Entry: 2fjh, 3.1 Å

PDB Description: Structure of the B20-4 Fab, a phage derived Fab fragment, in complex with VEGF

PDB Compounds: (W:) Vascular Endothelial Growth Factor A

SCOP Domain Sequences for d2fjhw1:

Sequence; same for both SEQRES and ATOM records:

>d2fjhw1 g.17.1.1 (W:14-108) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d2fjhw1:

• d2fjhw1 is new in SCOP 1.73
  
• d2fjhw1 appears in SCOP 1.75
  
• d2fjhw1 appears in the current release, SCOPe 2.08, called d2fjhw_