Lineage for d2fjhw_ (2fjh W:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2584898Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2584899Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2584900Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 2584973Protein automated matches [190290] (1 species)
    not a true protein
  7. 2584974Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)
  8. 2584987Domain d2fjhw_: 2fjh W: [133610]
    Other proteins in same PDB: d2fjha1, d2fjha2, d2fjhl1, d2fjhl2
    automated match to d1katv_

Details for d2fjhw_

PDB Entry: 2fjh (more details), 3.1 Å

PDB Description: Structure of the B20-4 Fab, a phage derived Fab fragment, in complex with VEGF
PDB Compounds: (W:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d2fjhw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjhw_ g.17.1.1 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkkd

SCOPe Domain Coordinates for d2fjhw_:

Click to download the PDB-style file with coordinates for d2fjhw_.
(The format of our PDB-style files is described here.)

Timeline for d2fjhw_: