SCOPe 2.08: Domain d2fjhv_: 2fjh V:

Lineage for d2fjhv_ (2fjh V:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein automated matches [190290] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries)

8. Domain d2fjhv_: 2fjh V: [133609]
   Other proteins in same PDB: d2fjha1, d2fjha2, d2fjhb_, d2fjhh_, d2fjhl1, d2fjhl2
   automated match to d1katv_

Details for d2fjhv_

PDB Entry: 2fjh, 3.1 Å

PDB Description: Structure of the B20-4 Fab, a phage derived Fab fragment, in complex with VEGF

PDB Compounds: (V:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d2fjhv_:

Sequence; same for both SEQRES and ATOM records:

>d2fjhv_ g.17.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpkkd

Timeline for d2fjhv_:

• d2fjhv_ first appeared in SCOP 1.73, called d2fjhv1
  
• d2fjhv_ appears in SCOPe 2.07