![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
![]() | Protein automated matches [190290] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187095] (7 PDB entries) |
![]() | Domain d2fjgw_: 2fjg W: [133608] Other proteins in same PDB: d2fjga1, d2fjga2, d2fjgb_, d2fjgh_, d2fjgl1, d2fjgl2 automated match to d1katv_ complexed with so4 |
PDB Entry: 2fjg (more details), 2.8 Å
SCOPe Domain Sequences for d2fjgw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjgw_ g.17.1.1 (W:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpk
Timeline for d2fjgw_: