Class g: Small proteins [56992] (92 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein automated matches [190290] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187095] (8 PDB entries) |
Domain d2fjgv_: 2fjg V: [133607] Other proteins in same PDB: d2fjga1, d2fjga2, d2fjgb1, d2fjgb2, d2fjgh1, d2fjgh2, d2fjgl1, d2fjgl2 automated match to d1katv_ complexed with so4 |
PDB Entry: 2fjg (more details), 2.8 Å
SCOPe Domain Sequences for d2fjgv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjgv_ g.17.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvptee snitmqimrikphqgqhigemsflqhnkcecrpkk
Timeline for d2fjgv_: