Lineage for d2fjgb1 (2fjg B:1-120)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929502Species Engineered (including hybrid species) [88562] (67 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 929573Domain d2fjgb1: 2fjg B:1-120 [133603]
    Other proteins in same PDB: d2fjgb2, d2fjgh2, d2fjgv_, d2fjgw_
    automatically matched to d1fvcb_
    complexed with so4

Details for d2fjgb1

PDB Entry: 2fjg (more details), 2.8 Å

PDB Description: Structure of the G6 Fab, a phage derived Fab fragment, in complex with VEGF
PDB Compounds: (B:) Fab heavy chain

SCOPe Domain Sequences for d2fjgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjgb1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy
adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss

SCOPe Domain Coordinates for d2fjgb1:

Click to download the PDB-style file with coordinates for d2fjgb1.
(The format of our PDB-style files is described here.)

Timeline for d2fjgb1: