Lineage for d2fjft2 (2fjf T:121-223)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026995Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2027002Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2027177Domain d2fjft2: 2fjf T:121-223 [133598]
    Other proteins in same PDB: d2fjfa1, d2fjfa2, d2fjfb1, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfe1, d2fjfe2, d2fjff1, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfi1, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfs1, d2fjfs2, d2fjft1, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfw1, d2fjfw2, d2fjfx1
    automatically matched to d1ngzb2

Details for d2fjft2

PDB Entry: 2fjf (more details), 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab
PDB Compounds: (T:) Heavy Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjft2:

Sequence, based on SEQRES records: (download)

>d2fjft2 b.1.1.2 (T:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2fjft2 b.1.1.2 (T:121-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2fjft2:

Click to download the PDB-style file with coordinates for d2fjft2.
(The format of our PDB-style files is described here.)

Timeline for d2fjft2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fjft1
View in 3D
Domains from other chains:
(mouse over for more information)
d2fjfa1, d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc1, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe1, d2fjfe2, d2fjff1, d2fjff2, d2fjfg1, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj1, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl1, d2fjfl2, d2fjfm1, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo1, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq1, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs1, d2fjfs2, d2fjfu1, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw1, d2fjfw2, d2fjfx1, d2fjfx2