Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Engineered (including hybrid species) [88562] (66 PDB entries) |
Domain d2fjfd1: 2fjf D:1-120 [133581] Other proteins in same PDB: d2fjfb2, d2fjfd2, d2fjff2, d2fjfh2, d2fjfi2, d2fjfk2, d2fjfn2, d2fjfp2, d2fjfr2, d2fjft2, d2fjfv2, d2fjfx2 automatically matched to d1fvcb_ |
PDB Entry: 2fjf (more details), 2.65 Å
SCOP Domain Sequences for d2fjfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjfd1 b.1.1.1 (D:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} evqlvesggglvqpggslrlscaasgftisdywihwvrqapgkglewvagitpaggytyy adsvkgrftisadtskntaylqmnslraedtavyycarfvfflpyamdywgqgtlvtvss
Timeline for d2fjfd1: