SCOP 1.75: Domain d2fjeb1: 2fje B:702-850

Lineage for d2fjeb1 (2fje B:702-850)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
   includes N-terminal partly folded tail

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)

8. Domain d2fjeb1: 2fje B:702-850 [133577]
   automatically matched to d1jnrb_
   complexed with fad, sf4

Details for d2fjeb1

PDB Entry: 2fje, 1.8 Å

PDB Description: adenosine-5-phosphosulfate reductase oxidized state

PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOP Domain Sequences for d2fjeb1:

Sequence; same for both SEQRES and ATOM records:

>d2fjeb1 d.58.1.5 (B:702-850) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

Timeline for d2fjeb1:

• d2fjeb1 first appeared in SCOP 1.73
  
• d2fjeb1 is called d2fjeb_ in SCOPe 2.01
  
• d2fjeb1 appears in the current release, SCOPe 2.08, called d2fjeb_