![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes N-terminal partly folded tail |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries) |
![]() | Domain d2fjdb_: 2fjd B: [133575] automated match to d1jnrb_ complexed with sf4, sfd |
PDB Entry: 2fjd (more details), 1.84 Å
SCOPe Domain Sequences for d2fjdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjdb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]} psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep teealksellagepeiigtsefpqvkkka
Timeline for d2fjdb_: