SCOP 1.75: Domain d2fjdb1: 2fjd B:702-850

Lineage for d2fjdb1 (2fjd B:702-850)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
   includes N-terminal partly folded tail

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)

8. Domain d2fjdb1: 2fjd B:702-850 [133575]
   automatically matched to d1jnrb_
   complexed with sf4, sfd

Details for d2fjdb1

PDB Entry: 2fjd, 1.84 Å

PDB Description: adenosine-5-phosphosulfate reductase in complex with sulfite (covalent adduct)

PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOP Domain Sequences for d2fjdb1:

Sequence; same for both SEQRES and ATOM records:

>d2fjdb1 d.58.1.5 (B:702-850) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

Timeline for d2fjdb1:

• d2fjdb1 first appeared in SCOP 1.73
  
• d2fjdb1 is called d2fjdb_ in SCOPe 2.01
  
• d2fjdb1 appears in the current release, SCOPe 2.08, called d2fjdb_