Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Treponema pallidum [TaxId:160] [187094] (1 PDB entry) |
Domain d2fjcp_: 2fjc P: [133574] Other proteins in same PDB: d2fjca1 automated match to d1jiga_ complexed with fe |
PDB Entry: 2fjc (more details), 2.5 Å
SCOPe Domain Sequences for d2fjcp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjcp_ a.25.1.0 (P:) automated matches {Treponema pallidum [TaxId: 160]} pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa esgdavtdgiitdilrtlgkaiwmlgatlka
Timeline for d2fjcp_: