Lineage for d2fjco_ (2fjc O:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1084172Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1084173Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1085586Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1085587Protein automated matches [190036] (15 species)
    not a true protein
  7. 1085788Species Treponema pallidum [TaxId:160] [187094] (1 PDB entry)
  8. 1085802Domain d2fjco_: 2fjc O: [133573]
    Other proteins in same PDB: d2fjca1
    automated match to d1jiga_
    complexed with fe

Details for d2fjco_

PDB Entry: 2fjc (more details), 2.5 Å

PDB Description: crystal structure of antigen tpf1 from treponema pallidum
PDB Compounds: (O:) Antigen TpF1

SCOPe Domain Sequences for d2fjco_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjco_ a.25.1.0 (O:) automated matches {Treponema pallidum [TaxId: 160]}
daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
sgdavtdgiitdilrtlgkaiwmlgatlka

SCOPe Domain Coordinates for d2fjco_:

Click to download the PDB-style file with coordinates for d2fjco_.
(The format of our PDB-style files is described here.)

Timeline for d2fjco_: