Lineage for d2fjcn_ (2fjc N:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705227Species Treponema pallidum [TaxId:160] [187094] (1 PDB entry)
  8. 2705240Domain d2fjcn_: 2fjc N: [133572]
    Other proteins in same PDB: d2fjca1
    automated match to d1jiga_
    complexed with fe

Details for d2fjcn_

PDB Entry: 2fjc (more details), 2.5 Å

PDB Description: crystal structure of antigen tpf1 from treponema pallidum
PDB Compounds: (N:) Antigen TpF1

SCOPe Domain Sequences for d2fjcn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjcn_ a.25.1.0 (N:) automated matches {Treponema pallidum [TaxId: 160]}
daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia
erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae
sgdavtdgiitdilrtlgkaiwmlgatlka

SCOPe Domain Coordinates for d2fjcn_:

Click to download the PDB-style file with coordinates for d2fjcn_.
(The format of our PDB-style files is described here.)

Timeline for d2fjcn_: