Lineage for d2fjci1 (2fjc I:27-177)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638728Protein Dodecameric ferritin homolog [47250] (13 species)
  7. 639004Species Treponema pallidum, TpF1 [TaxId:160] [140435] (1 PDB entry)
  8. 639013Domain d2fjci1: 2fjc I:27-177 [133567]
    automatically matched to 2FJC A:27-177
    complexed with fe

Details for d2fjci1

PDB Entry: 2fjc (more details), 2.5 Å

PDB Description: crystal structure of antigen tpf1 from treponema pallidum
PDB Compounds: (I:) Antigen TpF1

SCOP Domain Sequences for d2fjci1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjci1 a.25.1.1 (I:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]}
pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
esgdavtdgiitdilrtlgkaiwmlgatlka

SCOP Domain Coordinates for d2fjci1:

Click to download the PDB-style file with coordinates for d2fjci1.
(The format of our PDB-style files is described here.)

Timeline for d2fjci1: