SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2fjci_ (2fjc I:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (35 species)
    not a true protein
  7. 1991230Species Treponema pallidum [TaxId:160] [187094] (1 PDB entry)
  8. 1991238Domain d2fjci_: 2fjc I: [133567]
    Other proteins in same PDB: d2fjca1
    automated match to d1jiga_
    complexed with fe

Details for d2fjci_

PDB Entry: 2fjc (more details), 2.5 Å

PDB Description: Crystal structure of antigen TpF1 from Treponema pallidum
PDB Compounds: (I:) Antigen TpF1

SCOPe Domain Sequences for d2fjci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjci_ a.25.1.0 (I:) automated matches {Treponema pallidum [TaxId: 160]}
pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
esgdavtdgiitdilrtlgkaiwmlgatlka

SCOPe Domain Coordinates for d2fjci_:

Click to download the PDB-style file with coordinates for d2fjci_.
(The format of our PDB-style files is described here.)

Timeline for d2fjci_: