Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein Dodecameric ferritin homolog [47250] (13 species) |
Species Treponema pallidum, TpF1 [TaxId:160] [140435] (1 PDB entry) |
Domain d2fjcg1: 2fjc G:28-177 [133565] automatically matched to 2FJC A:27-177 complexed with fe |
PDB Entry: 2fjc (more details), 2.5 Å
SCOP Domain Sequences for d2fjcg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjcg1 a.25.1.1 (G:28-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} daraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdtia erllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaae sgdavtdgiitdilrtlgkaiwmlgatlka
Timeline for d2fjcg1: