Lineage for d2fjca1 (2fjc A:27-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2702115Species Treponema pallidum, TpF1 [TaxId:160] [140435] (1 PDB entry)
    Uniprot P16665 26-176
  8. 2702116Domain d2fjca1: 2fjc A:27-177 [133559]
    Other proteins in same PDB: d2fjcb_, d2fjcc_, d2fjcd_, d2fjce_, d2fjcf_, d2fjcg_, d2fjch_, d2fjci_, d2fjcj_, d2fjck_, d2fjcl_, d2fjcm_, d2fjcn_, d2fjco_, d2fjcp_
    complexed with fe

Details for d2fjca1

PDB Entry: 2fjc (more details), 2.5 Å

PDB Description: crystal structure of antigen tpf1 from treponema pallidum
PDB Compounds: (A:) Antigen TpF1

SCOPe Domain Sequences for d2fjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]}
pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti
aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa
esgdavtdgiitdilrtlgkaiwmlgatlka

SCOPe Domain Coordinates for d2fjca1:

Click to download the PDB-style file with coordinates for d2fjca1.
(The format of our PDB-style files is described here.)

Timeline for d2fjca1: