Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Dodecameric ferritin homolog [47250] (16 species) |
Species Treponema pallidum, TpF1 [TaxId:160] [140435] (1 PDB entry) Uniprot P16665 26-176 |
Domain d2fjca1: 2fjc A:27-177 [133559] Other proteins in same PDB: d2fjcb_, d2fjcc_, d2fjcd_, d2fjce_, d2fjcf_, d2fjcg_, d2fjch_, d2fjci_, d2fjcj_, d2fjck_, d2fjcl_, d2fjcm_, d2fjcn_, d2fjco_, d2fjcp_ complexed with fe |
PDB Entry: 2fjc (more details), 2.5 Å
SCOPe Domain Sequences for d2fjca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} pdaraiaaiceqlrqhvadlgvlyiklhnyhwhiygiefkqvhelleeyyvsvteafdti aerllqlgaqapasmaeylalsgiaeetekeitivsalarvkrdfeylstrfsqtqvlaa esgdavtdgiitdilrtlgkaiwmlgatlka
Timeline for d2fjca1: