SCOPe 2.08: Domain d2fjbd_: 2fjb D:

Lineage for d2fjbd_ (2fjb D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
   includes C-terminal partly folded tail

7. Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)

8. Domain d2fjbd_: 2fjb D: [133558]
   automated match to d1jnrb_
   complexed with amp, na, sf4, sfd

Details for d2fjbd_

PDB Entry: 2fjb, 1.7 Å

PDB Description: adenosine-5'-phosphosulfate reductase im complex with products

PDB Compounds: (D:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjbd_:

Sequence; same for both SEQRES and ATOM records:

>d2fjbd_ d.58.1.5 (D:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

Timeline for d2fjbd_:

• d2fjbd_ first appeared in SCOP 1.73, called d2fjbd1
  
• d2fjbd_ appears in SCOPe 2.07