![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes C-terminal partly folded tail |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries) |
![]() | Domain d2fjbd_: 2fjb D: [133558] automated match to d1jnrb_ complexed with amp, na, sf4, sfd |
PDB Entry: 2fjb (more details), 1.7 Å
SCOPe Domain Sequences for d2fjbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjbd_ d.58.1.5 (D:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]} psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep teealksellagepeiigtsefpqvkkka
Timeline for d2fjbd_: