Lineage for d2fjbb_ (2fjb B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556103Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes N-terminal partly folded tail
  7. 2556104Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. 2556107Domain d2fjbb_: 2fjb B: [133557]
    automated match to d1jnrb_
    complexed with amp, na, sf4, sfd

Details for d2fjbb_

PDB Entry: 2fjb (more details), 1.7 Å

PDB Description: adenosine-5'-phosphosulfate reductase im complex with products
PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjbb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOPe Domain Coordinates for d2fjbb_:

Click to download the PDB-style file with coordinates for d2fjbb_.
(The format of our PDB-style files is described here.)

Timeline for d2fjbb_: