Lineage for d2fjbb_ (2fjb B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
    includes C-terminal partly folded tail
  7. Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)
  8. Domain d2fjbb_: 2fjb B: [133557]
    automated match to d1jnrb_
    complexed with amp, na, sf4, sfd

Details for d2fjbb_

PDB Entry: 2fjb (more details), 1.7000000000000002 Å

PDB Description: adenosine-5'-phosphosulfate reductase im complex with products
PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjbb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

SCOPe Domain Coordinates for d2fjbb_ are not available.

Timeline for d2fjbb_:

Domains from other chains:
(mouse over for more information)
d2fjbd_