| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) ![]() |
| Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (13 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
| Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes N-terminal partly folded tail |
| Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries) |
| Domain d2fjad1: 2fja D:2702-2850 [133556] automatically matched to d1jnrb_ complexed with adx, fad, sf4 |
PDB Entry: 2fja (more details), 2 Å
SCOP Domain Sequences for d2fjad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjad1 d.58.1.5 (D:2702-2850) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka
Timeline for d2fjad1: