SCOPe 2.04: Domain d2fjab_: 2fja B:

Lineage for d2fjab_ (2fja B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
   includes N-terminal partly folded tail

7. Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)

8. Domain d2fjab_: 2fja B: [133555]
   automated match to d1jnrb_
   complexed with adx, fad, sf4

Details for d2fjab_

PDB Entry: 2fja, 2 Å

PDB Description: adenosine 5'-phosphosulfate reductase in complex with substrate

PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOPe Domain Sequences for d2fjab_:

Sequence; same for both SEQRES and ATOM records:

>d2fjab_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

Timeline for d2fjab_:

• d2fjab_ first appeared in SCOP 1.73, called d2fjab1
  
• d2fjab_ appears in SCOPe 2.03
  
• d2fjab_ appears in SCOPe 2.05
  
• d2fjab_ appears in the current release, SCOPe 2.08