SCOP 1.73: Domain d2fjab1: 2fja B:702-850

Lineage for d2fjab1 (2fja B:702-850)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other

6. Protein Adenylylsulfate reductase B subunit [69726] (1 species)
   includes N-terminal partly folded tail

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries)

8. Domain d2fjab1: 2fja B:702-850 [133555]
   automatically matched to d1jnrb_
   complexed with adx, fad, sf4

Details for d2fjab1

PDB Entry: 2fja, 2 Å

PDB Description: adenosine 5'-phosphosulfate reductase in complex with substrate

PDB Compounds: (B:) adenylylsulfate reductase, subunit B

SCOP Domain Sequences for d2fjab1:

Sequence; same for both SEQRES and ATOM records:

>d2fjab1 d.58.1.5 (B:702-850) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga
idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep
teealksellagepeiigtsefpqvkkka

Timeline for d2fjab1:

• d2fjab1 is new in SCOP 1.73
  
• d2fjab1 appears in SCOP 1.75
  
• d2fjab1 appears in the current release, SCOPe 2.08, called d2fjab_