Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Adenylylsulfate reductase B subunit [69726] (1 species) includes C-terminal partly folded tail |
Species Archaeoglobus fulgidus [TaxId:2234] [69727] (6 PDB entries) |
Domain d2fjab_: 2fja B: [133555] automated match to d1jnrb_ complexed with adx, fad, sf4 |
PDB Entry: 2fja (more details), 2 Å
SCOPe Domain Sequences for d2fjab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjab_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeoglobus fulgidus [TaxId: 2234]} psfvnpekcdgckalertaceyicpndlmtldkekmkaynrepdmcwecyscvkmcpqga idvrgyvdysplggacvpmrgtsdimwtvkyrngkvlrfkfairttpwgsiqpfegfpep teealksellagepeiigtsefpqvkkka
Timeline for d2fjab_: