Lineage for d2fj8a1 (2fj8 A:65-123)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2636664Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2636665Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2636691Protein automated matches [192457] (4 species)
    not a true protein
  7. 2636692Species Barley (Hordeum vulgare) [TaxId:4513] [254905] (2 PDB entries)
  8. 2636693Domain d2fj8a1: 2fj8 A:65-123 [133554]
    automated match to d1c2aa2

Details for d2fj8a1

PDB Entry: 2fj8 (more details), 1.19 Å

PDB Description: High resolution structure of barley Bowman-Birk inhibitor
PDB Compounds: (A:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d2fj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj8a1 g.3.13.1 (A:65-123) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
pweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprct

SCOPe Domain Coordinates for d2fj8a1:

Click to download the PDB-style file with coordinates for d2fj8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fj8a2