Lineage for d2fj8a1 (2fj8 A:64-122)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1459078Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1460483Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1460484Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1460485Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1460488Species Barley (Hordeum vulgare) [TaxId:4513] [57254] (3 PDB entries)
    further duplication: consist of two BBI domains
  8. 1460489Domain d2fj8a1: 2fj8 A:64-122 [133554]
    automatically matched to d1c2aa1

Details for d2fj8a1

PDB Entry: 2fj8 (more details), 1.19 Å

PDB Description: High resolution structure of barley Bowman-Birk inhibitor
PDB Compounds: (A:) Bowman-Birk type trypsin inhibitor

SCOPe Domain Sequences for d2fj8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj8a1 g.3.13.1 (A:64-122) Bowman-Birk inhibitor, BBI {Barley (Hordeum vulgare) [TaxId: 4513]}
rpweccdkaictrsnpptcrcvdevkkcaptcktclpsrsrpsrrvcidsyfgpvpprc

SCOPe Domain Coordinates for d2fj8a1:

Click to download the PDB-style file with coordinates for d2fj8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj8a1: