Lineage for d2fj7a1 (2fj7 A:38-135)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1482793Protein Histone H3 [47122] (6 species)
  7. 1482794Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)
  8. 1482866Domain d2fj7a1: 2fj7 A:38-135 [133548]
    Other proteins in same PDB: d2fj7b1, d2fj7d1, d2fj7f1, d2fj7h1
    automatically matched to d1p3ie_
    protein/DNA complex

Details for d2fj7a1

PDB Entry: 2fj7 (more details), 3.2 Å

PDB Description: crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d2fj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj7a1 a.22.1.1 (A:38-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2fj7a1:

Click to download the PDB-style file with coordinates for d2fj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fj7a1: